General Information

  • ID:  hor004757
  • Uniprot ID:  Q9LV87
  • Protein name:  Elicitor peptide 1
  • Gene name:  PROPEP1
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  Brassicaceae elicitor peptide family
  • Source:  Plant
  • Expression:  By wounding, methyl jasmonate (MeJA), ethylene. The expression of the peptide PEP1 precursor is induced by the mature peptide PEP1.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005515 protein binding
  • GO BP:  GO:0006952 defense response; GO:0009611 response to wounding; GO:0009723 response to ethylene; GO:0009753 response to jasmonic acid; GO:0045087 innate immune response
  • GO CC:  NA

Sequence Information

  • Sequence:  ATKVKAKQRGKEKVSSGRPGQHN
  • Length:  23(70-92)
  • Propeptide:  MEKSDRRSEESHLWIPLQCLDQTLRAILKCLGLFHQDSPTTSSPGTSKQPKEEKEDVTMEKEEVVVTSRATKVKAKQRGKEKVSSGRPGQHN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  9-9R->A: No effect.; 10-10R->A: No effect.; 11-11R->A: No effect.; 12-12R->A: No effect.; 13-13R->A: No effect.; 14-14R->A: No effect.; 15-15R->A: No effect.; 16-16R->A: No effect.; 17-17R->A: No effect.; 18-18R->A: No effect.; 19-19R->A: No effect.; 20-2

Activity

  • Function:  Elicitor of plant defense. Induces the production of plant defensin (PDF1.2) and of H(2)O(2). Promotes resistance to the root fungal pathogen P.irregulare.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  PEPR1, PEPR2
  • Target Unid:   Q9SSL9, Q9FZ59
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004757_AF2.pdbhor004757_ESM.pdb

Physical Information

Mass: 288442 Formula: C104H183N39O32
Absent amino acids: CDFILMWY Common amino acids: K
pI: 11.88 Basic residues: 8
Polar residues: 7 Hydrophobic residues: 4
Hydrophobicity: -168.7 Boman Index: -8163
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 33.91
Instability Index: 3088.7 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  16785434
  • Title:  An endogenous peptide signal in Arabidopsis activates components of the innate immune response.
  • PubMed ID:  18824048
  • Title:   Structure-activity Studies of AtPep1, a Plant Peptide Signal Involved in the Innate Immune Response